Web stats for Ogniter - ogniter.org
Free online database for the browser game Ogame. Cartography, statistics & tools. Information about the Fantasy Browser Game Ogame.
2.00 Rating by ClearWebStats
ogniter.org is 1 decade 1 year 7 months old. This website has a #184,232 rank in global traffic. It has a .org as an domain extension. This website has a Google PageRank of 2 out of 10. This domain is estimated value of $ 37,200.00 and has a daily earning of $ 62.00. Additionally, the website is monetizing using Adsense. While no active threats were reported recently by users, ogniter.org is SAFE to browse.
Traffic Report of Ogniter
Daily Unique Visitors: | 4,962 |
Daily Pageviews: | 24,810 |
Estimated Valuation
Income Per Day: | $ 62.00 |
Estimated Worth: | $ 37,200.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | 27 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Excellent |
WOT Privacy: | Excellent |
WOT Child Safety: | Excellent |
Website Ranks & Scores
Google Pagerank
PR 2 out of 10
PageSpeed Score
72
Siteadvisor Rating
Not Applicable
Where is ogniter.org server located?
Social Engagement
Facebook Shares: | 33 |
Facebook Likes: | 4 |
Facebook Comments: | 1 |
Twitter Count (Tweets): | 4 |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 1 |
H3 Headings: | 4 | H4 Headings: | Not Applicable |
H5 Headings: | 1 | H6 Headings: | Not Applicable |
Total IFRAMEs: | 1 | Total Images: | 2 |
Google Adsense: | pub-1243866001028722 | Google Analytics: | UA-34506622-1 |
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 03 Sep 2014 15:00:49 GMT
Server: Apache/2.2.24 (Unix) mod_ssl/2.2.24 OpenSSL/1.0.0-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.14
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: User-Agent,Accept-Encoding
Content-Encoding: gzip
Content-Length: 6010
Connection: close
Content-Type: text/html; charset=utf-8
Status-Code: 200
Status: 200 OK
Date: Wed, 03 Sep 2014 15:00:49 GMT
Server: Apache/2.2.24 (Unix) mod_ssl/2.2.24 OpenSSL/1.0.0-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.14
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: User-Agent,Accept-Encoding
Content-Encoding: gzip
Content-Length: 6010
Connection: close
Content-Type: text/html; charset=utf-8
Domain Information for ogniter.org
Domain Registrar: | Public Interest Registry |
---|---|
Registration Date: | 2012-09-17 1 decade 1 year 7 months ago |
Owner's E-Mail: | [email protected] |
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
ogniter.org | A | 3525 |
IP:216.224.166.183 |
ogniter.org | NS | 3600 |
Target:ns.myhosting.com |
ogniter.org | NS | 3600 |
Target:ns1.myhosting.com |
ogniter.org | NS | 3600 |
Target:ns2.myhosting.com |
ogniter.org | SOA | 3600 |
MNAME:ns.myhosting.com RNAME:neoarcknight.gmail.com Serial:1264619998 Refresh:14400 Retry:7200 Expire:2419200 |
ogniter.org | MX | 3600 |
Priority:10 Target:mail.ogniter.org |
Similarly Ranked Websites to Ogniter
www.CRUISE.co.uk: Largest Cruises Site, Deals, Reviews
- cruise.co.uk
Cheap Cruises, Last Minute Deals & Free Upgrades, Over 35,000 Cruise Reviews & 10,000 Photos. Great deals on Cruises from Southampton & all UK ports.
Village vacances VVF : locations, clubs, résidences et villages de vacances en France
- vvf-villages.fr
En village vacances VVF Villages, partez en vacances à la découverte de la France, avec 100 villages de vacances au cœur de nos plus belles régions.
Actividades de infantil y primaria – Recursos para trabajar en infantil y primaria
- actividadesdeinfantilyprimaria.com
Recursos para trabajar en infantil y primaria